Proteintech, 22879-1-AP, B3GNT7 Polyclonal antibody

Size: 20ul / 150ul The B3GNT7 (22879-1-AP) by Proteintech is a Polyclonal antibody targeting B3GNT7 in WB, IHC, ELISA applications with reactivity to human, mouse samples 22879-1-AP targets B3GNT7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, COLO 320 cells, mouse placenta tissue Positive IHC detected in: human colon cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:500 Background Information B3GNT7, the glycosyltransferase gene that was most significantly upregulated by IL-22 treatment, encodes an N-acetylglucosaminyltransferase involved in the biosynthesis of polyLacNAc repeats of keratan sulfate (PMID: 34864058). B3GNT7 was initially identified in 2002 and is notable for high expression in healthy intestinal epithelial cells (PMID: 38886669). Overexpressed B3GNT7 were correlated with poor prognosis in breast cancer patients based on public datasets. B3GNT7 was shown to be a potential biomarker for unfavorable outcomes and therapeutic target of breast cancer (PMID: 37740763). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18890 Product name: Recombinant human B3GNT7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-164 aa of BC148680 Sequence: PGQFLQEPPPPTLEPQKAQKPNGQLVNPNNFWKNPKDVAAPTPMASQGPQAWDVTTTNCSANINLTHQPWFQVLEPQFRQFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGRERQSA Predict reactive species Full Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 Calculated Molecular Weight: 330 aa, 37 kDa Observed Molecular Weight: 40-46 kDa GenBank Accession Number: BC148680 Gene Symbol: B3GNT7 Gene ID (NCBI): 93010 RRID: AB_2879182 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NFL0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.