Iright
BRAND / VENDOR: Proteintech

Proteintech, 22944-1-AP, ZBTB10 Polyclonal antibody

CATALOG NUMBER: 22944-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZBTB10 (22944-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB10 in WB, IP, ELISA applications with reactivity to human, mouse samples 22944-1-AP targets ZBTB10 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells Positive IP detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Zinc finger and BTB domain-containing protein 10 (ZBTB10), also known as RINZF, RINZFC, May be involved in transcriptional regulation. Multiple isoforms of ZBTB10 exist due to alternative splicing events. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19094 Product name: Recombinant human ZBTB10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 299-519 aa of BC127098 Sequence: PESVVVDYNNRKPVNRDGLSSSRDQKIASFWATRNLTNLASNVKIENDGCNVDEGQIENYQMNDSSWVQDGSPEMAENESEGQTKVFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGPDGDRNVNANLLAEAGTSQDGGDAGTSHDFKYGLMPGPSNDFKYGLIPGTSNDFKYGLIPGAS Predict reactive species Full Name: zinc finger and BTB domain containing 10 Calculated Molecular Weight: 871 aa, 95 kDa Observed Molecular Weight: 65 kDa, 130 kDa GenBank Accession Number: BC127098 Gene Symbol: ZBTB10 Gene ID (NCBI): 65986 RRID: AB_2879188 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96DT7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924