Iright
BRAND / VENDOR: Proteintech

Proteintech, 22980-1-AP, PRODH Polyclonal antibody

CATALOG NUMBER: 22980-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The PRODH (22980-1-AP) by Proteintech is a Polyclonal antibody targeting PRODH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 22980-1-AP targets PRODH in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, A549 cells, rat liver tissue Positive IHC detected in: human cerebellum tissue, human liver cancer tissue, human breast cancer tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information PRODH(Proline dehydrogenase 1, mitochondrial) is also named as PIG6, HSPOX2, PRODH1, PRODH2, POX, SCZD4, TP53I6 and belongs to the proline oxidase family. It is an oxidoreductase involved in the transfer of redox potential across the mitochondrial membrane and catalyzes the rate-limiting oxidation of proline to pyrroline- 5-carboxylate (P5C). High PRODH activity is sufficient to induce mitochondria-mediated apoptosis in the presence of proline. Defects in PRODH are the cause of hyperprolinemia type 1 (HP-1) and defects in PRODH are associated with susceptibility to schizophrenia type 4 (SCZD4). This protein has 3 isoforms produced by alternative splicing with the molecular mass of 68 kDa, 59 kDa and 56 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18429 Product name: Recombinant human PRODH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 143-492 aa of BC118597 Sequence: LAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGIASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA Predict reactive species Full Name: proline dehydrogenase (oxidase) 1 Calculated Molecular Weight: 600 aa, 68 kDa Observed Molecular Weight: 56 kDa, 66 kDa GenBank Accession Number: BC118597 Gene Symbol: PRODH Gene ID (NCBI): 5625 RRID: AB_2879191 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43272 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924