Iright
BRAND / VENDOR: Proteintech

Proteintech, 22988-1-AP, CDKAL1 Polyclonal antibody

CATALOG NUMBER: 22988-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CDKAL1 (22988-1-AP) by Proteintech is a Polyclonal antibody targeting CDKAL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 22988-1-AP targets CDKAL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, HepG2 cells, HT-1080 cells, Jurkat cells Positive IHC detected in: human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Cell cycle progression is controlled, in part, by a family of cyclin dependent kinases (Cdks) that work to phosphorylate key substrates involved in each phase of cell cycle progression. Cdks are the catalytic subunits of serine/threonine protein kinases, a large family of proteins that act as regulators of the eukaryotic cell cycle. CDKAL1 (Cdk5 regulatory subunit associated protein 1-like 1) is a 579 amino acid single-pass membrane protein that contains one TRAM domain and is similar to Cdk5 regulatory subunit associated proteins (CDK5RAPs). Expressed in pancreas, brain and skeletal muscle, CDKAL1 uses iron as a cofactor and is involved in glucose-stimulated INS secretion. Defects in the gene encoding CDKAL1 impair INS secretion and are associated with the development of type 2 diabetes. Multiple isoforms of CDKAL1 exist due to alternative splicing events. This antibody recognizes the 65kd isoform of CDKAL1. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19060 Product name: Recombinant human CDKAL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-357 aa of BC121020 Sequence: MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITENASDADLWLLNSCTVKNPAEDHFRNSIKKAQEENKKIVLAGCVPQAQPRQDYLKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKDNGRRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGNLASYPIDELVDRAKQSFQEGVCEIWLTSEDTGAYGRDIGTNLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHPRVYAFLHIPVQSASDSVLMEMKREYCVADFKRVVDFLKEKVPGIT Predict reactive species Full Name: CDK5 regulatory subunit associated protein 1-like 1 Calculated Molecular Weight: 579 aa, 65 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC121020 Gene Symbol: CDKAL1 Gene ID (NCBI): 54901 RRID: AB_2879192 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q5VV42 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924