Proteintech, 22989-1-AP, MMP12 Polyclonal antibody

Size: 20ul / 150ul The MMP12 (22989-1-AP) by Proteintech is a Polyclonal antibody targeting MMP12 in WB, ELISA applications with reactivity to human, mouse, rat samples 22989-1-AP targets MMP12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information MMP12(Matrix metalloproteinase-12) is a 54 kDa proenzyme that is processed into a 45 kDa and then a 22 kDa active form(15723202). MMP9 and MMP12 promote intimal thickening by independent cleavage of N-cadherin, which elevates vascular smooth muscle cell proliferation via beta-catenin signalling. Its overexpression in myeloid lineage cells plays a key role in modulating myelopoiesis, immune suppression, and lung tumorigenesis(PMID: 21378275). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rabbit, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19068 Product name: Recombinant human MMP12 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 231-402 aa of BC112301 Sequence: DPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWR Predict reactive species Full Name: matrix metallopeptidase 12 (macrophage elastase) Calculated Molecular Weight: 470 aa, 54 kDa Observed Molecular Weight: 54 kDa, 45 kDa GenBank Accession Number: BC112301 Gene Symbol: MMP12 Gene ID (NCBI): 4321 RRID: AB_2879193 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P39900 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.