Product Description
Size: 20ul / 150ul
The GBP6 (23001-1-AP) by Proteintech is a Polyclonal antibody targeting GBP6 in WB, IHC, ELISA applications with reactivity to human samples
23001-1-AP targets GBP6 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, MCF-7 cells
Positive IHC detected in: human testis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:5000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Background Information
Guanylate-binding protein 6 (GBP6) is a member of the guanylate-binding protein family and is best known as a gene induced by interferon-γ signalling. Interferon-γ is produced predominantly by NK and T-cells, indicating that GBP6 is involved in host immune response (PMID: 28747659, 27029383). GBP6 has 2 isoforms with the molecular mass of 34 and 72 kDa.
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag19196 Product name: Recombinant human GBP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 530-633 aa of BC131713 Sequence: LKEKLQMEREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF Predict reactive species
Full Name: guanylate binding protein family, member 6
Calculated Molecular Weight: 633 aa, 72 kDa
Observed Molecular Weight: 70 kDa
GenBank Accession Number: BC131713
Gene Symbol: GBP6
Gene ID (NCBI): 163351
RRID: AB_2879195
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen Affinity purified
UNIPROT ID: Q6ZN66
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924