Iright
BRAND / VENDOR: Proteintech

Proteintech, 23001-1-AP, GBP6 Polyclonal antibody

CATALOG NUMBER: 23001-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GBP6 (23001-1-AP) by Proteintech is a Polyclonal antibody targeting GBP6 in WB, IHC, ELISA applications with reactivity to human samples 23001-1-AP targets GBP6 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Positive IHC detected in: human testis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Guanylate-binding protein 6 (GBP6) is a member of the guanylate-binding protein family and is best known as a gene induced by interferon-γ signalling. Interferon-γ is produced predominantly by NK and T-cells, indicating that GBP6 is involved in host immune response (PMID: 28747659, 27029383). GBP6 has 2 isoforms with the molecular mass of 34 and 72 kDa. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19196 Product name: Recombinant human GBP6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 530-633 aa of BC131713 Sequence: LKEKLQMEREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGVSSLFKKHKLPF Predict reactive species Full Name: guanylate binding protein family, member 6 Calculated Molecular Weight: 633 aa, 72 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC131713 Gene Symbol: GBP6 Gene ID (NCBI): 163351 RRID: AB_2879195 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q6ZN66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924