Proteintech, 23002-1-AP, SORCS1 Polyclonal antibody

Size: 20ul / 150ul The SORCS1 (23002-1-AP) by Proteintech is a Polyclonal antibody targeting SORCS1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23002-1-AP targets SORCS1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, Y79 cells Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SORCS1, also named as SorCS, belongs to the family of VPS10 domain-containing receptors. SorCS1 immunoreactivity is widespread in a population of neurons throughout the brain. Two different types of cellular localization were observed. Most SorCS1 immunoreactive neurons exhibit a punctate cytoplasmic staining which extends into the dendrites, whilst occassionally SorCS1 neuronal immunoreactivity is associated with the plasma membrane.The predicted molecular weight (MW) of SORCS1 is 130 kDa, and the 60-80 kDa bands observed may represent degradation products. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19199 Product name: Recombinant human SORCS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-156 aa of BC131597 Sequence: GGGSCCPSPHPSSAPRSASTPRGFSHQGRPGRAPATPLPLVVRPLFSVAPGDRALSLERARGTGASMAVAARSGRRRRSGADQEKAERGEGASRSPRGVLRDGGQQEPGTRERDPDKATRFRME Predict reactive species Full Name: sortilin-related VPS10 domain containing receptor 1 Calculated Molecular Weight: 1168 aa, 130 kDa GenBank Accession Number: BC131597 Gene Symbol: SORCS1 Gene ID (NCBI): 114815 RRID: AB_2879196 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8WY21 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.