Product Description
Size: 20ul / 150ul
The CENPV (23005-1-AP) by Proteintech is a Polyclonal antibody targeting CENPV in WB, ELISA applications with reactivity to human samples
23005-1-AP targets CENPV in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293 cells, HepG2 cells, L02 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag19210 Product name: Recombinant human CENPV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC137486 Sequence: MRRSRSSAAAKLRGQKRSGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLT Predict reactive species
Full Name: centromere protein V
Calculated Molecular Weight: 275 aa, 30 kDa
Observed Molecular Weight: 30-33 kDa
GenBank Accession Number: BC137486
Gene Symbol: CENPV
Gene ID (NCBI): 201161
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen Affinity purified
UNIPROT ID: Q7Z7K6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924