Proteintech, 23005-1-AP, CENPV Polyclonal antibody

Size: 20ul / 150ul The CENPV (23005-1-AP) by Proteintech is a Polyclonal antibody targeting CENPV in WB, ELISA applications with reactivity to human samples 23005-1-AP targets CENPV in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19210 Product name: Recombinant human CENPV protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC137486 Sequence: MRRSRSSAAAKLRGQKRSGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLT Predict reactive species Full Name: centromere protein V Calculated Molecular Weight: 275 aa, 30 kDa Observed Molecular Weight: 30-33 kDa GenBank Accession Number: BC137486 Gene Symbol: CENPV Gene ID (NCBI): 201161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q7Z7K6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.