Proteintech, 23045-1-AP, OXTR Polyclonal antibody

Size: 20ul / 150ul The OXTR (23045-1-AP) by Proteintech is a Polyclonal antibody targeting OXTR in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 23045-1-AP targets OXTR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, L02 cells Positive IP detected in: L02 cells Positive IHC detected in: mouse placenta tissue, human breast cancer tissue, human hysteromyoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Oxytocin (OXT) is a neurohypophysial hormone that plays a role in lactation and parturition and in the central nervous system as a neurotransmitter involved in sex and maternal behavior (PMID: 1852313; 10811917). OXT acts through its receptor, OXTR, which belongs to the G protein-coupled 7-transmembrane receptor family. OXTR is expressed in the endometrium, myometrium, and mammary gland (PMID: 1313946). This antibody is raised against the C-terminal region of human OXTR. Two immunoreactive OXTR bands were found in the fat tissue, an unglycosylated 43 kDa form and a mature glycosylated 67 kDa form (PMID:32819381). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19074 Product name: Recombinant human OXTR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 327-389 aa of BC137443 Sequence: WIYMLFTGHLFHELVQRFLCCSASYLKGRRLGETSASKKSNSSSFVLSHRSSSQRSCSQPSTA Predict reactive species Full Name: OXTR Calculated Molecular Weight: 389 aa, 43 kDa Observed Molecular Weight: 46 kDa, 67 kDa GenBank Accession Number: BC137443 Gene Symbol: OXTR Gene ID (NCBI): 5021 RRID: AB_2827425 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30559 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.