Iright
BRAND / VENDOR: Proteintech

Proteintech, 23046-1-AP, SPRR2D Polyclonal antibody

CATALOG NUMBER: 23046-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SPRR2D (23046-1-AP) by Proteintech is a Polyclonal antibody targeting SPRR2D in IHC, ELISA applications with reactivity to human samples 23046-1-AP targets SPRR2D in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human oesophagus tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19079 Product name: Recombinant human SPRR2D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC120938 Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPSPKCPQPCPPQQCQQKY Predict reactive species Full Name: small proline-rich protein 2D Calculated Molecular Weight: 72 aa, 8 kDa GenBank Accession Number: BC120938 Gene Symbol: SPRR2D Gene ID (NCBI): 6703 RRID: AB_2879202 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P22532 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924