Proteintech, 23079-1-AP, CD99 Polyclonal antibody

Size: 20ul / 150ul The CD99 (23079-1-AP) by Proteintech is a Polyclonal antibody targeting CD99 in WB, IHC, ELISA applications with reactivity to human samples 23079-1-AP targets CD99 in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, U-937 cells, THP-1 cells Positive IHC detected in: human pancreas tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information CD99, also known as MIC2, is a heavily O-glycosylated transmembrane protein involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. CD99 is broadly distributed on many cell types, with particularly strong expression on human cortical thymocytes, Ewing's sarcoma cells and peripheral primitive neuroectodermal tumors (PMID: 9794396; 16984917). In normal cells, CD99 has been functionally implicated in cell adhesion, migration, apoptosis, differentiation, activation, and proliferation of lymphocytes and monocyte extravasation and transport of several transmembrane proteins (PMID: 16984917). CD99 displays two surface isoforms generated by alternative splicing: a long 32 kDa and a short 28 kDa form (PMID: 12368226). Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19461 Product name: Recombinant human CD99 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-115 aa of BC021620 Sequence: LSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHR Predict reactive species Full Name: CD99 molecule Calculated Molecular Weight: 19 kDa, 16 kDa, 17 kDa Observed Molecular Weight: 28 kDa, 32 kDa GenBank Accession Number: BC021620 Gene Symbol: CD99 Gene ID (NCBI): 4267 RRID: AB_2879205 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P14209 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.