Proteintech, 23081-1-AP, Alpha smooth muscle actin Polyclonal antibody

Size: 20ul / 150ul The Alpha smooth muscle actin (23081-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha smooth muscle actin in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 23081-1-AP targets Alpha smooth muscle actin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse brown adipose tissue, mouse kidney tissue, mouse liver tissue, mouse skeletal muscle tissue, rat heart tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: human heart tissue, mouse skeletal muscle tissue, human colon tissue, human liver cancer tissue, stromal tumor tissue, human hysteromyoma tissue, human liver tissue, human small intestine tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:1000 Background Information ACTA2 (also known as α-smooth muscle actin or α-SMA) belongs to the actin family. Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. ACTA2 is primarily expressed in vascular smooth muscle and anti-ACTA2 is commonly used to marker smooth muscle cells. This antibody is specific to the ACTA2. It selectively stains the vascular smooth muscle but not cardiac or skeletal muscle. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19481 Product name: Recombinant human ACTA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC017554 Sequence: MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG Predict reactive species Full Name: actin, alpha 2, smooth muscle, aorta Calculated Molecular Weight: 377 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC017554 Gene Symbol: Alpha smooth muscle actin Gene ID (NCBI): 59 RRID: AB_2815024 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.