Proteintech, 23094-1-AP, LRRTM2 Polyclonal antibody

Size: 20ul / 150ul The LRRTM2 (23094-1-AP) by Proteintech is a Polyclonal antibody targeting LRRTM2 in WB, ELISA applications with reactivity to human, mouse samples 23094-1-AP targets LRRTM2 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spinal cord tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Leucine-rich repeat transmembrane proteins (LRRTMs) are synaptic cell adhesion molecules. LRRTMs are highly localized in the postsynaptic density and play various roles in the formation, maturation, and function of synapses (PMID: 25951919). LRRTM2 acts as a post-synaptic ligand of Neurexins. LRRTM2 regulates excitatory synapse development and function in the vertebrate nervous system (PMID: 20064387). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19422 Product name: Recombinant human LRRTM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 38-136 aa of BC126408 Sequence: CRCEKLLFYCDSQGFHSVPNATDKGSLGLSLRHNHITELERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNKIFYLPNTTFTQLINLQ Predict reactive species Full Name: leucine rich repeat transmembrane neuronal 2 Calculated Molecular Weight: 516 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC126408 Gene Symbol: LRRTM2 Gene ID (NCBI): 26045 RRID: AB_2879209 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O43300 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.