Proteintech, 23115-1-AP, TMEM63C Polyclonal antibody

Size: 20ul / 150ul The TMEM63C (23115-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM63C in WB, ELISA applications with reactivity to human, mouse samples 23115-1-AP targets TMEM63C in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, unboiled mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TMEM63C, also known as CSC1, is a member of the TMEM family. TMEM63C is expressed in kidney and associated with podocyte function (PMID: 32750436). Patients with focal segmental glomerulosclerosis exhibited specific TMEM63C loss in podocytes. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19428 Product name: Recombinant human TMEM63C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 693-806 aa of BC136613 Sequence: LLIAMVIAFVGIFLGKLRMVADYEPEEEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMNNQPEEGEEESGLRGFARELDSAQFQEGLELEGQNQYH Predict reactive species Full Name: transmembrane protein 63C Calculated Molecular Weight: 806 aa, 93 kDa Observed Molecular Weight: 93 kDa GenBank Accession Number: BC136613 Gene Symbol: TMEM63C Gene ID (NCBI): 57156 RRID: AB_3085706 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9P1W3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.