Proteintech, 23117-1-AP, ESRP2 Polyclonal antibody

Size: 20ul / 150ul The ESRP2 (23117-1-AP) by Proteintech is a Polyclonal antibody targeting ESRP2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23117-1-AP targets ESRP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, HepG2 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ESRP2 (Epithelial Splicing Regulatory Protein 2), also known as RBM35B(RNA binding motif protein 35B), is a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) family of RNA binding proteins. ESRP2 plays a role in the regulation of alternative splicing events of pre-mRNAs(PMID: 27401076). Overexpression of ESRP2 has been described in various malignant tumors, such as pancreatic ductal adenocarcinoma, oral squamous carcinoma, ovarian cancer, and luminal-type breast cancer(PMID: 33339518). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19436 Product name: Recombinant human ESRP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 576-717 aa of BC030146 Sequence: TYTTFQATPTLIPTETAALYPSSALLPAARVPAAPTPVAYYPGPATQLYLNYTAYYPSPPVSPTTVGYLTTPTAALASAPTSVLSQSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL Predict reactive species Full Name: epithelial splicing regulatory protein 2 Calculated Molecular Weight: 727 aa, 78 kDa Observed Molecular Weight: 78 kDa GenBank Accession Number: BC030146 Gene Symbol: ESRP2 Gene ID (NCBI): 80004 RRID: AB_2879213 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6T0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.