Proteintech, 23126-1-AP, WDR36 Polyclonal antibody

Size: 20ul / 150ul The WDR36 (23126-1-AP) by Proteintech is a Polyclonal antibody targeting WDR36 in WB, IP, ELISA applications with reactivity to human, mouse samples 23126-1-AP targets WDR36 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells Positive IP detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19425 Product name: Recombinant human WDR36 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 602-938 aa of BC136517 Sequence: FSISVLDIETRKIVREFSGHQGQINDMAFSPDGRWLISAAMDCSIRTWDLPSGCLIDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPKSAPFFIPTIPGLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDFCLKLEEGLVNNKYDTALNLLKESGPSGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQ Predict reactive species Full Name: WD repeat domain 36 Calculated Molecular Weight: 951 aa, 105 kDa Observed Molecular Weight: 99-105 kDa GenBank Accession Number: BC136517 Gene Symbol: WDR36 Gene ID (NCBI): 134430 RRID: AB_3669407 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8NI36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.