Iright
BRAND / VENDOR: Proteintech

Proteintech, 23166-1-AP, ATXN3L Polyclonal antibody

CATALOG NUMBER: 23166-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ATXN3L (23166-1-AP) by Proteintech is a Polyclonal antibody targeting ATXN3L in WB, IHC, ELISA applications with reactivity to human samples 23166-1-AP targets ATXN3L in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ATXN3L, also named as Ataxin-3-like protein, is a 355 amino acid protein, which contains 1 Josephin domain and 2 UIM (ubiquitin-interacting motif) domains. ATXN3L localizes in the nucleus and as a deubiquitinating enzyme that cleaves both 'Lys-48'-linked and 'Lys-63'-linked poly-ubiquitin chains. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19611 Product name: Recombinant human ATXN3L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 180-341 aa of BC137187 Sequence: IISVEEMDTPKLNGKKLVKQKEHRVYKTVLEKVSEESDESGTSDQDEEDFQRALELSRQETNREDEHLRSTIELSMQGSSGNTSQDLPKTSCVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEDTVQAAVDTI Predict reactive species Full Name: ataxin 3-like Calculated Molecular Weight: 355 aa, 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC137187 Gene Symbol: ATXN3L Gene ID (NCBI): 92552 RRID: AB_2879221 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3M9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924