Proteintech, 23172-1-AP, ERVWE1 Polyclonal antibody

Size: 20ul / 150ul The ERVWE1 (23172-1-AP) by Proteintech is a Polyclonal antibody targeting ERVWE1 in WB, ELISA applications with reactivity to human, mouse, rat samples 23172-1-AP targets ERVWE1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ERVWE1 encodes a 538 amino-acid, 73-kDa glycosylated (60 kDa unglycosylated) envelope protein, Syncytin-1. It is expressed in the placental syncytiotrophoblast and participates in syncytium formation during placenta morphogenesis. Mounting evidence suggests that aberrant expression of ERVWE1 involves the etiology of schizophrenia. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19227 Product name: Recombinant human ERVWE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 274-371 aa of BC137381 Sequence: TSAYRCLNGSSESMCFLSFLVPPMTIYTEQDLYSYVISKPRNKRVPILPFVIGAGVLGALGTGIGGITTSTQFYYKLSQELNGDMERVADSLVTLQDQ Predict reactive species Full Name: endogenous retroviral family W, env(C7), member 1 Calculated Molecular Weight: 538 aa, 60 kDa Observed Molecular Weight: 70-73 kDa GenBank Accession Number: BC137381 Gene Symbol: ERVWE1 Gene ID (NCBI): 30816 RRID: AB_3085707 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UQF0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.