Iright
BRAND / VENDOR: Proteintech

Proteintech, 23197-1-AP, KCTD8 Polyclonal antibody

CATALOG NUMBER: 23197-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KCTD8 (23197-1-AP) by Proteintech is a Polyclonal antibody targeting KCTD8 in WB, ELISA applications with reactivity to human samples 23197-1-AP targets KCTD8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information GABA-B receptors are G protein-coupled receptors for gamma-aminobutyric acid (GABA). KCTD8 appears to function as an auxiliary GABA-B receptor subunit that may influence the biophysical and/or pharmacologic properties of the receptor response. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19555 Product name: Recombinant human KCTD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 360-473 aa of BC136793 Sequence: CDSHSEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSKKKVCEKLSVEEEMKKCIQDFKKIHIPDYFPERKRQWQSELLQKYGL Predict reactive species Full Name: potassium channel tetramerisation domain containing 8 Calculated Molecular Weight: 473 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC136793 Gene Symbol: KCTD8 Gene ID (NCBI): 386617 RRID: AB_3669411 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZWB6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924