Proteintech, 23226-1-AP, ATG2A Polyclonal antibody

Size: 20ul / 150ul The ATG2A (23226-1-AP) by Proteintech is a Polyclonal antibody targeting ATG2A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 23226-1-AP targets ATG2A in WB, IHC, IF/ICC, IP, CoIP, ELISA, Peptide array applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, MCF-7 cells, Raji cells Positive IP detected in: K-562 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Autophagy-related protein 2 homolog A (ATG2A) belongs to the ATG2 family. ATG2A is a lipid transfer protein involved in autophagosome assembly (PMID:31271352). ATG2A tethers the edge of the isolation membrane (IM) to the endoplasmic reticulum (ER) and mediates direct lipid transfer from ER to IM for IM expansion. ATG2A binds to the ER exit site (ERES), which is the membrane source for autophagosome formation, and extracts phospholipids from the membrane source and transfers them to ATG9 (ATG9A or ATG9B) to the IM for membrane expansion (PMID: 30952800, PMID: 31271352). ATG2A also regulates lipid droplet morphology and distribution within the cell (PMID: 28561066). The observed MW of ATG2A is 215 kDa. Specification Tested Reactivity: human Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19709 Product name: Recombinant human ATG2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-539 aa of BC110650 Sequence: RVQRLEYCDEAVRDPSQAPPVDVHQPPAFLHKLLQLAGVRLHYEELPAQEEPPEPPLQIGSCSGYMELMVKLKQNEAFPGPKLEVAGQLGSLHLLLTPRQLQQLQELLSAVSLTDHEGLADKLNKSRPLGAEDLWLIEQDLNQQLQAGAVAEPLSPDPLTNPLLNLDNTDLFFSMAGLTSSVASALSELSLSDVDLASSVRSDMASRRLSAQAHPAGKMAPNPLLDTMRPDSLLKMTLGGVTLTLLQTSAPSSGPPDLATHFFTEFDATKDGPFGSRDFHHLRPRFQRACPCSHVRLTGTAVQLSWELRTGSRGRRTTSMEVHFGQLEVLECLWPRGTSEPEYTEI Predict reactive species Full Name: ATG2 autophagy related 2 homolog A (S. cerevisiae) Calculated Molecular Weight: 1938 aa, 213 kDa Observed Molecular Weight: 215 kDa GenBank Accession Number: BC110650 Gene Symbol: ATG2A Gene ID (NCBI): 23130 RRID: AB_2879235 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q2TAZ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.