Proteintech, 23288-1-AP, TRIF/TICAM1 Polyclonal antibody

Size: 20ul / 150ul The TRIF/TICAM1 (23288-1-AP) by Proteintech is a Polyclonal antibody targeting TRIF/TICAM1 in WB, IHC, ELISA applications with reactivity to human samples 23288-1-AP targets TRIF/TICAM1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MOLT-4 cells, Ramos cells, Raji cells Positive IHC detected in: human brain tissue, human testis tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TRIF (adaptor-induced interferon-β containing the tir domain) is a key adapter protein in Toll-like receptor signaling, mediating the MyD88-independent pathway of TLR3 and TLR4. It activates NF-κB and interferon regulator 3 (IRF3), leading to the production of type I interferon and pro-inflammatory cytokines. TRIF recruits TRAF3 to activate TBK1/IKKε kinases and interacts with RIPK1, playing a crucial dual role in antiviral and inflammatory innate immune responses.(PMID: 12855817; 14519765; 28469251) Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19779 Product name: Recombinant human TICAM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-200 aa of BC035331 Sequence: LDEHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE Predict reactive species Full Name: toll-like receptor adaptor molecule 1 Calculated Molecular Weight: 712 aa, 76 kDa Observed Molecular Weight: 66-76 kDa GenBank Accession Number: BC035331 Gene Symbol: TRIF Gene ID (NCBI): 148022 RRID: AB_2879247 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUC6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.