Iright
BRAND / VENDOR: Proteintech

Proteintech, 23301-1-AP, UPF3B Polyclonal antibody

CATALOG NUMBER: 23301-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The UPF3B (23301-1-AP) by Proteintech is a Polyclonal antibody targeting UPF3B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 23301-1-AP targets UPF3B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, K-562 cells, Jurkat cells, mouse brain tissue Positive IHC detected in: human ovary tumor tissue, human skeletal muscle tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Regulator of nonsense transcripts 3B (UPF3B) is also named as RENT3B, and belongs to the RENT3 family. UPF3B is a core junction protein in the Nonsense-mediated RNA decay (NMD) pathway, involved in the exonuclear transport and quality supervision of mRNA. And UPF3B showed heightened expression in hepatocellular carcinoma (HCC) tissues and was linked with adverse prognosis (PMID: 38889220). UPF3B promotes the dissociation of post-termination ribosomal complexes that lack nascent peptide. UPF3B could promote ribosome recycling, and UPF3B serves as a direct regulator of translation termination (PMID: 29333258). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18568 Product name: Recombinant human UPF3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 288-470 aa of BC121017 Sequence: AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQEHILRERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRLCPPDDSTKSGDSAAERKQESGISHRKEGGEE Predict reactive species Full Name: UPF3 regulator of nonsense transcripts homolog B (yeast) Calculated Molecular Weight: 483 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC121017 Gene Symbol: UPF3B Gene ID (NCBI): 65109 RRID: AB_2879249 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZI7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924