Proteintech, 23317-1-AP, p57Kip2 Polyclonal antibody

Size: 20ul / 150ul The p57Kip2 (23317-1-AP) by Proteintech is a Polyclonal antibody targeting p57Kip2 in WB, IHC, ELISA applications with reactivity to human samples 23317-1-AP targets p57Kip2 in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, SH-SY5Y cells, Jurkat cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information CDKN1C, also named as p57KIP2 and KIP2, belongs to the CDI family. CDKN1C is a potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. It is a negative regulator of cell proliferation. CDKN1C may play a role in maintenance of the non-proliferative state throughout life. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19849 Product name: Recombinant human CDKN1C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-316 aa of BC067842 Sequence: MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR Predict reactive species Full Name: cyclin-dependent kinase inhibitor 1C (p57, Kip2) Calculated Molecular Weight: 316 aa, 32 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC067842 Gene Symbol: p57 Kip2/CDKN1C Gene ID (NCBI): 1028 RRID: AB_2879254 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49918 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.