Proteintech, 23326-1-AP, GPR39 Polyclonal antibody

Size: 20ul / 150ul The GPR39 (23326-1-AP) by Proteintech is a Polyclonal antibody targeting GPR39 in IHC, ELISA applications with reactivity to human samples 23326-1-AP targets GPR39 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR39 (G protein-coupled receptor 39), a member of the ghrelin family of G protein-coupled receptors, is zinc-responsive and contributes to the regulation of diverse neurovascular and neurologic functions (PMID: 34360964). GPR39 has relatively high ligand-independent constitutive activity, based on an aromatic cluster on the inner face of the extracellular ends of TM domains VI and VII, similar to other members of the ghrelin receptor family (PMID: 33918078). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19913 Product name: Recombinant human GPR39 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 336-453 aa of BC125046 Sequence: SSVINPLLYTVSSQQFRRVFVQVLCCRLSLQHANHEKRLRVHAHSTTDSARFVQRPLLFASRRQSSARRTEKIFLSTFQSEAEPQSKSQSLSLESLEPNSGAKPANSAAENGFQEHEV Predict reactive species Full Name: G protein-coupled receptor 39 Calculated Molecular Weight: 453 aa, 51 kDa GenBank Accession Number: BC125046 Gene Symbol: GPR39 Gene ID (NCBI): 2863 RRID: AB_2879255 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43194 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.