Proteintech, 23327-1-AP, CAMLG Polyclonal antibody

Size: 20ul / 150ul The CAMLG (23327-1-AP) by Proteintech is a Polyclonal antibody targeting CAMLG in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 23327-1-AP targets CAMLG in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, human testis tissue, Jurkat cells, mouse testis tissue, U-87 MG cells, mouse brain tissue, rat brain tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19915 Product name: Recombinant human CAMLG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-184 aa of BC130325 Sequence: MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEE Predict reactive species Full Name: calcium modulating ligand Calculated Molecular Weight: 296 aa, 33 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC130325 Gene Symbol: CAMLG Gene ID (NCBI): 819 RRID: AB_2879256 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49069 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.