Iright
BRAND / VENDOR: Proteintech

Proteintech, 23340-1-AP, TOPBP1 Polyclonal antibody

CATALOG NUMBER: 23340-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TOPBP1 (23340-1-AP) by Proteintech is a Polyclonal antibody targeting TOPBP1 in WB, ELISA applications with reactivity to human samples 23340-1-AP targets TOPBP1 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Human DNA topoisomerase II binding protein 1 (TopBP1) contains eight BRCT motifs that are found in proteins regulating the DNA damage response, transcription, and replication (1). In addition, TopBP1 shares sequence similarity with the fission yeast Rad4/Cut5 protein and the budding yeast DPB11 protein, both of which are required for DNA damage control and/or replication checkpoint control (2,3). Phosphorylation of TopBP1 occurs in response to DNA double-strand breaks and replication blocks (2). TopBP1 forms nuclear foci and localizes to the sites of DNA damage or the arrested replication forks (2,3). Downregulation of TopBP1 leads to reduced cell survival, probably due to increased apoptosis (2). TopBP1 functions as a transcriptional coactivator by enhancing the human papillomavirus (HPV) transcription/replication factor E2 (1). In addition, the HECT-domain ubiquitin ligase, hHYD, cooperates with TopBP1 in DNA damage response (4). TopBP1 specifically interacts with the C-terminal region of topoisomerase II beta, which suggests a supportive role for TopBP1 in the catalytic reactions of topoisomerase II beta through transient breakages of DNA strands (5). The gene encoding TopBP1 maps to chromosome 3q22.2 (5). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18961 Product name: Recombinant human TOPBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-335 aa of BC126209 Sequence: MHHQRCVPRAEHPVYNMVMSDVTISCTSLEKEKREEVHKYVQMMGGRVYRDLNVSVTHLIAGEVGSKKYLVAANLKKPILLPSWIKTLWEKSQEKKITRYTDINMEDFKCPIFLGCIICVTGLCGLDRKEVQQLTVKHGGQYMGQLKMNECTHLIVQEPKGQKYECAKRWNVHCVTTQWFFDSIEKGFCQDESIYKTEPRPEAKTMPNSSTPTSQINTIDSRTLSDVSNISNINASCVSESICNSLNSKLEPTLENLENLDVSAFQAPEDLLDGCRIYLCGFSGRKLDKLRRLINSGGGVRFNQLNEDVTHVIVGDYDDELKQFWNKSAHRPHVV Predict reactive species Full Name: topoisomerase (DNA) II binding protein 1 Calculated Molecular Weight: 1522 aa, 171 kDa Observed Molecular Weight: 171 kDa GenBank Accession Number: BC126209 Gene Symbol: TOPBP1 Gene ID (NCBI): 11073 RRID: AB_2879258 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q92547 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924