Proteintech, 23351-1-AP, AMOTL2 Polyclonal antibody

Size: 20ul / 150ul The AMOTL2 (23351-1-AP) by Proteintech is a Polyclonal antibody targeting AMOTL2 in WB, IP, ELISA applications with reactivity to human samples 23351-1-AP targets AMOTL2 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Angiomotin‑like 2 (AMOTL2) is a member of the motin family of angiostatin‑binding proteins. The motin family, also known as AMOTs, consists of three members: AMOT, AMOT-like 1 (AMOTL1) and AMOTL2. Members of the motin family are a type of adaptor proteins mainly distributed in the cytomembrane, cytoplasm or nucleus, and have a higher expression in the endothelial cells of capillaries and in larger vessels of the placenta. Human AmotL2 encodes two isoforms of a molecular mass of 100 kDa and 60 kDa.(PMID: 34036399,PMID: 25080976) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19953 Product name: Recombinant human AMOTL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 340-466 aa of BC011454 Sequence: DPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI Predict reactive species Full Name: angiomotin like 2 Calculated Molecular Weight: 779 aa, 86 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC011454 Gene Symbol: AMOTL2 Gene ID (NCBI): 51421 RRID: AB_2879263 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2J4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.