Iright
BRAND / VENDOR: Proteintech

Proteintech, 23443-1-AP, KHDC1 Polyclonal antibody

CATALOG NUMBER: 23443-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The KHDC1 (23443-1-AP) by Proteintech is a Polyclonal antibody targeting KHDC1 in WB, IHC, ELISA applications with reactivity to human samples 23443-1-AP targets KHDC1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells Positive IHC detected in: human stomach cancer tissue, human liver tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KHDC1, also named as C6orf148, belongs to the KHDC1 family. KHDC1 has two isoforms with calculated MW 27 kDa and 18 kDa. It's a membrane protein. We got 35-40 kDa in our WB detection. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20115 Product name: Recombinant human KHDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-237 aa of BC022080 Sequence: DLSLAPRISGTVCLSVPQPSPYQVIGCSGFHLSSLYP Predict reactive species Full Name: KH homology domain containing 1 Calculated Molecular Weight: 237 aa, 27 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC022080 Gene Symbol: KHDC1 Gene ID (NCBI): 80759 RRID: AB_2879280 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q4VXA5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924