Proteintech, 23540-1-AP, PCF11 Polyclonal antibody

Size: 20ul / 150ul The PCF11 (23540-1-AP) by Proteintech is a Polyclonal antibody targeting PCF11 in WB, IHC, IP, ELISA applications with reactivity to human samples 23540-1-AP targets PCF11 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells Positive IP detected in: Jurkat cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information In Saccharomyces cerevisiae, the cleavage/polyadenylation factor Pcf11 is a crucial regulatory factor required for recruiting polyadenylation machinery to elongating RNA polymerase II (RNAPII), and is necessary for correct transcriptional termination. Pcf11 (PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae)), is a 1,555 amino acid nuclear protein that is a component of pre-mRNA cleavage complex II. It is suggested that Pcf11 is capable of promoting the dissociation of Pol II elongation complexes from DNA. Pcf11 contains a CTD-interaction domain that binds in a phospho-dependent manner to the heptad repeats within the RNA polymerase II CTD. The gene encoding Pcf11 is located on human chromosoem 11, which houses over 1,400 genes and comprises nearly 4% of the human genome. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are associated with defects in genes that maps to chromosome 11. This antibody is specific to the 173kd human PCF11 protein. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20263 Product name: Recombinant human PCF11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1206-1555 aa of BC146778 Sequence: IPAPMTVGNIQASQQVLSGVAQPVAFGQGQQFLPVHPQNPGFVQNPSGALPKAYPDNHLSQVDVNELFSKLLKTGILKLSQTDSATTQVSEVTAQPPPEEEEDQNEDQDVPDLTNFTVEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV Predict reactive species Full Name: PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae) Calculated Molecular Weight: 1555 aa, 173 kDa Observed Molecular Weight: 173 kDa GenBank Accession Number: BC146778 Gene Symbol: PCF11 Gene ID (NCBI): 51585 RRID: AB_2879293 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O94913 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.