Proteintech, 23546-1-AP, Retinal S antigen Polyclonal antibody

Size: 20ul / 150ul The Retinal S antigen (23546-1-AP) by Proteintech is a Polyclonal antibody targeting Retinal S antigen in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 23546-1-AP targets Retinal S antigen in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue Positive IF-P detected in: rat eye tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20318 Product name: Recombinant human SAG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 332-405 aa of BC156656 Sequence: QIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE Predict reactive species Full Name: S-antigen; retina and pineal gland (arrestin) Calculated Molecular Weight: 405 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC156656 Gene Symbol: Retinal S antigen Gene ID (NCBI): 6295 RRID: AB_2879294 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10523 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.