Product Description
Size: 20ul / 150ul
The HTR6 (23561-1-AP) by Proteintech is a Polyclonal antibody targeting HTR6 in IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples
23561-1-AP targets HTR6 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse brain tissue, rat brain tissue
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15396 Product name: Recombinant human HTR6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 311-440 aa of BC074996 Sequence: CNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGPRPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNFFNIDPAEPELRPHPLGIPTN Predict reactive species
Full Name: 5-hydroxytryptamine (serotonin) receptor 6
Calculated Molecular Weight: 440 aa, 47 kDa
GenBank Accession Number: BC074996
Gene Symbol: HTR6
Gene ID (NCBI): 3362
RRID: AB_2879296
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen Affinity purified
UNIPROT ID: P50406
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924