Proteintech, 23591-1-AP, GRB10 Polyclonal antibody

Size: 20ul / 150ul The GRB10 (23591-1-AP) by Proteintech is a Polyclonal antibody targeting GRB10 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 23591-1-AP targets GRB10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, mouse liver tissue, rat brain tissue Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GRB10 is an adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. GRB10 has three consensus domains including pleckstrin homology (PH) domain, SH2/SH3 domain and Ras-associating domain. By binding to kinases, GRB10 suppresses signals from activated receptors tyrosine kinases, including INSR and IGF1R. It may play a role in mediating ubiquitination of INSR, leading to proteasomal degradation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20355 Product name: Recombinant human GRB10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC024285 Sequence: MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAI Predict reactive species Full Name: growth factor receptor-bound protein 10 Calculated Molecular Weight: 536aa,61 kDa; 594aa,67 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC024285 Gene Symbol: GRB10 Gene ID (NCBI): 2887 RRID: AB_2879301 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13322 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.