Product Description
Size: 20ul / 150ul
The NPS (23609-1-AP) by Proteintech is a Polyclonal antibody targeting NPS in IHC, ELISA applications with reactivity to human samples
23609-1-AP targets NPS in IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IHC detected in: human pancreas cancer tissue, human brain tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20322 Product name: Recombinant human NPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-89 aa of BC156665 Sequence: YPVPSSKVSGKSDYFLILLNSCPTRLDRSKELAFLKPILEKMFVKRSFRNGVGTGMKKTSFQRAKS Predict reactive species
Full Name: neuropeptide S
Calculated Molecular Weight: 89 aa, 10 kDa
GenBank Accession Number: BC156665
Gene Symbol: NPS
Gene ID (NCBI): 594857
RRID: AB_2879303
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen Affinity purified
UNIPROT ID: P0C0P6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924