Proteintech, 23624-1-AP, FBXL19 Polyclonal antibody

Size: 20ul / 150ul The FBXL19 (23624-1-AP) by Proteintech is a Polyclonal antibody targeting FBXL19 in WB, ELISA applications with reactivity to human samples 23624-1-AP targets FBXL19 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20198 Product name: Recombinant human FBXL19 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 444-524 aa of BC059173 Sequence: SVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLRSCRQLSPEACARLAAAGPPGPFRCPEEKLLLKDS Predict reactive species Full Name: F-box and leucine-rich repeat protein 19 Calculated Molecular Weight: 694 aa, 76 kDa Observed Molecular Weight: 60-75 kDa GenBank Accession Number: BC059173 Gene Symbol: FBXL19 Gene ID (NCBI): 54620 RRID: AB_3085713 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q6PCT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.