Iright
BRAND / VENDOR: Proteintech

Proteintech, 23624-1-AP, FBXL19 Polyclonal antibody

CATALOG NUMBER: 23624-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FBXL19 (23624-1-AP) by Proteintech is a Polyclonal antibody targeting FBXL19 in WB, ELISA applications with reactivity to human samples 23624-1-AP targets FBXL19 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20198 Product name: Recombinant human FBXL19 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 444-524 aa of BC059173 Sequence: SVHLLTAPTSPLRETLVHLNLAGCHRLTDHCLPLFRRCPRLRRLDLRSCRQLSPEACARLAAAGPPGPFRCPEEKLLLKDS Predict reactive species Full Name: F-box and leucine-rich repeat protein 19 Calculated Molecular Weight: 694 aa, 76 kDa Observed Molecular Weight: 60-75 kDa GenBank Accession Number: BC059173 Gene Symbol: FBXL19 Gene ID (NCBI): 54620 RRID: AB_3085713 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q6PCT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924