Iright
BRAND / VENDOR: Proteintech

Proteintech, 23652-1-AP, P15RS Polyclonal antibody

CATALOG NUMBER: 23652-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The P15RS (23652-1-AP) by Proteintech is a Polyclonal antibody targeting P15RS in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 23652-1-AP targets P15RS in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, mouse liver tissue, mouse skeletal muscle tissue, L02 cells, Jurkat cells, HEK-293 cells Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RPRD1A is upregulated in cells overexpressing cyclin-dependent kinase inhibitor p15(INK4b) and may have a role in cell cycle regulation. It contains a RAR domain that is involved in regulation of nuclear pre-mRNA, which suggests that P15RS may act as a nuclear regulation protein [PMID:12470661]. It also interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. Besides, RPRD1A regulates cell cycle genes and attenuates WNT signaling [PMID: 20739273], and acts as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle [PMID: 22231121]. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20409 Product name: Recombinant human P15RS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-167 aa of BC010136 Sequence: APVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLV Predict reactive species Full Name: regulation of nuclear pre-mRNA domain containing 1A Calculated Molecular Weight: 312 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC010136 Gene Symbol: RPRD1A Gene ID (NCBI): 55197 RRID: AB_2879306 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96P16 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924