Iright
BRAND / VENDOR: Proteintech

Proteintech, 23746-1-AP, C20orf112 Polyclonal antibody

CATALOG NUMBER: 23746-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The C20orf112 (23746-1-AP) by Proteintech is a Polyclonal antibody targeting C20orf112 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23746-1-AP targets C20orf112 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information C20orf112 ,also termed as chromosome 20 open reading frame 112, is a 436 amino acid protein, which consists of a relatively hydrophobic N terminal region and two putative small coiled-coil domains. C20orf112 may likely involve in endocytosis pathway and normal brain development. It also is required to mediate the cell energy response. The function of C20orf112 is still non-known and mechanism is required to further study. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20690 Product name: Recombinant human C20orf112 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-166 aa of BC065370 Sequence: SSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNGAVAPMDFTTAAEDQPINLCDKLPPATALGTASYPSDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDD Predict reactive species Full Name: chromosome 20 open reading frame 112 Calculated Molecular Weight: 436 aa, 47 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC065370 Gene Symbol: C20orf112 Gene ID (NCBI): 140688 RRID: AB_2879315 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96MY1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924