Proteintech, 23762-1-AP, RSK2 Polyclonal antibody

Size: 20ul / 150ul The RSK2 (23762-1-AP) by Proteintech is a Polyclonal antibody targeting RSK2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples 23762-1-AP targets RSK2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, K-562 cells, MCF-7 cells, HepG2 cells Positive IP detected in: K-562 cells Positive IHC detected in: human kidney tissue, mouse colon tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: HepG2 cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:2000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information RPS6KA3(Ribosomal protein S6 kinase alpha-3) is also named as ISPK1, MAPKAPK1B, RSK2 and belongs to the protein kinase superfamily. It localizes at the kinetochores under spindle checkpoint conditions, and during mitosis, associated with the centrosomes, the spindle and at the mid-body(PMID:20383198). It is required for EGF activated phosphorylation of histone H3, which may cause chromatin remodeling and facilitate gene transcription and maybe playing an essential regulatory role in protein synthesis during cell proliferation. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20620 Product name: Recombinant human RPS6KA3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 666-740 aa of BC096301 Sequence: QRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL Predict reactive species Full Name: ribosomal protein S6 kinase, 90kDa, polypeptide 3 Calculated Molecular Weight: 740 aa, 84 kDa Observed Molecular Weight: 84 kDa GenBank Accession Number: BC096301 Gene Symbol: RSK2 Gene ID (NCBI): 6197 RRID: AB_2879318 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51812 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.