Proteintech, 23786-1-AP, PTPRU Polyclonal antibody

Size: 20ul / 150ul The PTPRU (23786-1-AP) by Proteintech is a Polyclonal antibody targeting PTPRU in WB, IF/ICC, ELISA applications with reactivity to human samples 23786-1-AP targets PTPRU in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, U-251 cells Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PTPRU (protein tyrosine phosphatase, receptor type, U) is also named as PCP-2,PTP-J, PTP pi, PTP-RO and R-PTP-psi. Protein tyrosine phosphatase plays a crucial role in the regulation of signal transduction during diverse cell functions, including cell activation, proliferation, differentiation, survival, and metabolic homeostasis. PTPases are classified into two groups, membrane-spanning receptor-type (R-PTPases) and cytosolictype. The human PTPRU cDNA clone encodes a polypeptide of 1,439 amino acids and the predicted molecular mass of the PTPRU protein is 162 kDa. It has reported that SCF induced tyrosine phosphorylation of the full-length PTPRU (190 kDa) and the proteolytic forms of PTPRU (100 and 80 kD). A non-tyrosine phosphorylated 73 kDa band was detected in addition to those of 190, 90, and 80 kDa. (PMID: 10397721). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20667 Product name: Recombinant human PTPRU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-146 aa of BC146655 Sequence: ETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVYVRVNGGPLGSAVWNMTGSHGRQWHQA Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, U Calculated Molecular Weight: 1446 aa, 162 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: BC146655 Gene Symbol: PTPRU Gene ID (NCBI): 10076 RRID: AB_3669416 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q92729 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.