Proteintech, 23823-1-AP, CNGA2 Polyclonal antibody

Size: 20ul / 150ul The CNGA2 (23823-1-AP) by Proteintech is a Polyclonal antibody targeting CNGA2 in WB, ELISA applications with reactivity to human, mouse, rat samples 23823-1-AP targets CNGA2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Cyclic nucleotide-gated (CNG) channels are crucial for visual and olfactory transductions (PMID: 12432397). Native CNG channels are heterotetramers composed of homologous A and B subunits. The olfactory CNG channels are composed of two CNGA2 subunits, one CNGA4 and one CNGB1b subunit, each containing a cyclic nucleotide-binding domain (PMID: 22786723). CNGA2, also named as CNCA, CNCA1 and CNCG2, is the primary subunit of the olfactory CNG channel. Odorant signal transduction is probably mediated by a G-protein coupled cascade using cAMP as second messenger. Activation of olfactory channel by cyclic nucleotides leads to a depolarization of olfactory sensory neurons. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19899 Product name: Recombinant human CNGA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 575-664 aa of BC126302 Sequence: REILMKEGLLDENEVATSMEVDVQEKLGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPELAAADEP Predict reactive species Full Name: cyclic nucleotide gated channel alpha 2 Calculated Molecular Weight: 664 aa, 76 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC126302 Gene Symbol: CNGA2 Gene ID (NCBI): 1260 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q16280 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.