Iright
BRAND / VENDOR: Proteintech

Proteintech, 23833-1-AP, LYRM7 Polyclonal antibody

CATALOG NUMBER: 23833-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The LYRM7 (23833-1-AP) by Proteintech is a Polyclonal antibody targeting LYRM7 in IHC, IF/ICC, ELISA applications with reactivity to human samples 23833-1-AP targets LYRM7 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissue, human hepatocirrhosis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20696 Product name: Recombinant human LYRM7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC047079 Sequence: MGRAVKVLQLFKTLHRTRQQVFKNDARALEAARIKINEEFKNNKSETSSKKIEELMKIGSDIELLLRTSVIQGIHTDHNTLKLVPRKDLLVENVPYCDAPTQKQ Predict reactive species Full Name: Lyrm7 homolog (mouse) Calculated Molecular Weight: 104 aa, 12 kDa GenBank Accession Number: BC047079 Gene Symbol: LYRM7 Gene ID (NCBI): 90624 RRID: AB_2879332 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q5U5X0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924