Iright
BRAND / VENDOR: Proteintech

Proteintech, 23841-1-AP, NAT8L Polyclonal antibody

CATALOG NUMBER: 23841-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NAT8L (23841-1-AP) by Proteintech is a Polyclonal antibody targeting NAT8L in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 23841-1-AP targets NAT8L in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HUVEC cells, mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NAT8L (N-acetyltransferase 8-like) catalyzes the formation of N-acetyl aspartate (NAA) from acetyl-CoA and aspartate. In the brain, NAA delivers the acetate moiety to synthesize acetyl-CoA, which is further used for fatty acid generation (PMID: 24155240). NAT8L modulation may impinge on the metabolic reprogramming of cancer cells (PMID: 36580805). The calculated MW of NAT8L is around 33 kDa, and the observed MW is around 45 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20832 Product name: Recombinant human NAT8L protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-134 aa of BC103748 Sequence: MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE Predict reactive species Full Name: N-acetyltransferase 8-like (GCN5-related, putative) Calculated Molecular Weight: 134 aa, 15 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC103748 Gene Symbol: NAT8L Gene ID (NCBI): 339983 RRID: AB_3669418 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q8N9F0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924