Proteintech, 23842-1-AP, NDUFC1 Polyclonal antibody

Size: 20ul / 150ul The NDUFC1 (23842-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFC1 in IHC, ELISA applications with reactivity to human samples 23842-1-AP targets NDUFC1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human heart tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20835 Product name: Recombinant human NDUFC1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-76 aa of BC107682 Sequence: MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGLE Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 1, 6kDa Calculated Molecular Weight: 76 aa, 9 kDa GenBank Accession Number: BC107682 Gene Symbol: NDUFC1 Gene ID (NCBI): 4717 RRID: AB_2879336 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43677 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.