Iright
BRAND / VENDOR: Proteintech

Proteintech, 23850-1-AP, GPR83 Polyclonal antibody

CATALOG NUMBER: 23850-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GPR83 (23850-1-AP) by Proteintech is a Polyclonal antibody targeting GPR83 in WB, ELISA applications with reactivity to human samples 23850-1-AP targets GPR83 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20873 Product name: Recombinant human GPR83 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 316-423 aa of BC067473 Sequence: SSKVIRTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRIELKALLSMCQRPPKPQEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPIVTMS Predict reactive species Full Name: G protein-coupled receptor 83 Calculated Molecular Weight: 423 aa, 48 kDa Observed Molecular Weight: 48-55 kDa GenBank Accession Number: BC067473 Gene Symbol: GPR83 Gene ID (NCBI): 10888 RRID: AB_2879340 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924