Product Description
Size: 20ul / 150ul
The BCHE (23854-1-AP) by Proteintech is a Polyclonal antibody targeting BCHE in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
23854-1-AP targets BCHE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, HEK-293 cells
Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HeLa cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
BCHE(butyrylcholinesterase) is an enzyme expressed in most human tissues. It may have a greater role in cholinergic transmission than previously surmised, making BChE inhibition an important therapeutic goal in Alzheimer's disease(PMID:11848688). BCHE is also named as CHE1 and belongs to the type-B carboxylesterase/lipase family. This is a glycoprotein with the molecular weight from 68 kDa to 90 kDa.
Specification
Tested Reactivity: human
Cited Reactivity: human, goat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20888 Product name: Recombinant human BCHE protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 539-602 aa of BC008396 Sequence: MTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL Predict reactive species
Full Name: butyrylcholinesterase
Calculated Molecular Weight: 602 aa, 68 kDa
Observed Molecular Weight: 85-90 kDa
GenBank Accession Number: BC008396
Gene Symbol: BCHE
Gene ID (NCBI): 590
RRID: AB_2879341
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen Affinity purified
UNIPROT ID: P06276
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924