Iright
BRAND / VENDOR: Proteintech

Proteintech, 23887-1-AP, ODF2L Polyclonal antibody

CATALOG NUMBER: 23887-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ODF2L (23887-1-AP) by Proteintech is a Polyclonal antibody targeting ODF2L in WB, ELISA applications with reactivity to human, mouse, rat samples 23887-1-AP targets ODF2L in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information ODF2L, also named as KIAA1229, has many isoforms with MW 60-80 kDa. The function of ODF2L (Outer dense fiber protein 2-like) remains largely unknown. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20897 Product name: Recombinant human ODF2L protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-38 aa of BC009779 Sequence: SLETKIAKWNLQSRMNKNEAIVMKEASRQKTVALKKGI Predict reactive species Full Name: outer dense fiber of sperm tails 2-like Calculated Molecular Weight: 513 aa, 60 kDa Observed Molecular Weight: 60-74 kDa GenBank Accession Number: BC009779 Gene Symbol: ODF2L Gene ID (NCBI): 57489 RRID: AB_2879351 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9ULJ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924