Iright
BRAND / VENDOR: Proteintech

Proteintech, 23895-1-AP, CEBPD Polyclonal antibody

CATALOG NUMBER: 23895-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CEBPD (23895-1-AP) by Proteintech is a Polyclonal antibody targeting CEBPD in WB, ELISA applications with reactivity to human, mouse samples 23895-1-AP targets CEBPD in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, MDA-MB-231 cells, SK-BR-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CEBPD, a versatile transcription factor, belongs to the C/EBP family that comprises three parts: an N-terminal transactivating region, a basic DNA binding region, and a C-terminal leucine zipper domain (PMID: 17170124). It presents as a regulator in terms of cell differentiation, proliferation, motility, growth arrest, and cell death (PMID: 24155666). The apparent molecular weight is larger than the calculated molecular weight of 28 kDa, which is likely due to posttranslational modification, presumably by ubiquitination. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20953 Product name: Recombinant human CEBPD protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-193 aa of BC105109 Sequence: MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAIDFSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLKREPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDRGSPE Predict reactive species Full Name: CCAAT/enhancer binding protein (C/EBP), delta Calculated Molecular Weight: 269 aa, 28 kDa Observed Molecular Weight: 28-36 kDa GenBank Accession Number: BC105109 Gene Symbol: CEBPD Gene ID (NCBI): 1052 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P49716 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924