Proteintech, 23899-1-AP, TNFSF18 Polyclonal antibody

Size: 20ul / 150ul The TNFSF18 (23899-1-AP) by Proteintech is a Polyclonal antibody targeting TNFSF18 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23899-1-AP targets TNFSF18 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SGC-7901 cells Positive IHC detected in: human thyroid cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:500 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20979 Product name: Recombinant human TNFSF18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-177 aa of BC069319 Sequence: MCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFLCSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 18 Calculated Molecular Weight: 177 aa, 20 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC069319 Gene Symbol: TNFSF18 Gene ID (NCBI): 8995 RRID: AB_2879355 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UNG2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.