Iright
BRAND / VENDOR: Proteintech

Proteintech, 23907-1-AP, OXNAD1 Polyclonal antibody

CATALOG NUMBER: 23907-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The OXNAD1 (23907-1-AP) by Proteintech is a Polyclonal antibody targeting OXNAD1 in WB, ELISA applications with reactivity to human samples 23907-1-AP targets OXNAD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20998 Product name: Recombinant human OXNAD1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-312 aa of BC008322 Sequence: MACAAVMIPGLLRCSVGAIRIEAASLRLTLSTLRHLTLTSIMKSKRKTDHMERTASVLRREIVSAAKVCGAASESPSVKSLRLLVADQDFSFKAGQWVDFFIPGVSVVGGFSICSSPRLLEQERVIELAVKYTNHPPALWVHNTCTLDCEVAVRVGGEFFFDPQPADASRNLVLIAGGVGINPLLSILRHAADLLREQANKRNGYEIGTIKLFYSAKNTSELLFKKNILDLVNEFPEKIACSLHVTKQTTQINAELKPYITEGRITEKEIRDHISKETLFYICGPPPMTDFFSKQLENNHVPKEHICFEKWW Predict reactive species Full Name: oxidoreductase NAD-binding domain containing 1 Calculated Molecular Weight: 312 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC008322 Gene Symbol: OXNAD1 Gene ID (NCBI): 92106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96HP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924