Proteintech, 23923-1-AP, C14orf126 Polyclonal antibody

Size: 20ul / 150ul The C14orf126 (23923-1-AP) by Proteintech is a Polyclonal antibody targeting C14orf126 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 23923-1-AP targets C14orf126 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, mouse cerebellum tissue, HepG2 cells, mouse lung tissue Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information C14orf126, also named D-aminoacyl-tRNA deacylase 2 (DTD2), can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site. Plants are unique in possessing two distinct chiral proofreading systems, D-aminoacyl-tRNA deacylase1 (DTD1) and DTD2, of bacterial and archaeal origins, respectively. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21053 Product name: Recombinant human C14orf126 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-168 aa of BC010618 Sequence: MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF Predict reactive species Full Name: chromosome 14 open reading frame 126 Calculated Molecular Weight: 168 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC010618 Gene Symbol: C14orf126 Gene ID (NCBI): 112487 RRID: AB_3669426 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96FN9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.