Proteintech, 23933-1-AP, LY6H Polyclonal antibody

Size: 20ul / 150ul The LY6H (23933-1-AP) by Proteintech is a Polyclonal antibody targeting LY6H in WB, IHC, ELISA applications with reactivity to human, mouse samples 23933-1-AP targets LY6H in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human testis tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information LY6H is highly expressed in particular subdivisions of human brain and also in MOLT-3 and -4 acute lymphoblastic leukemia cells. It has some isoforms with MW 14-16 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20762 Product name: Recombinant human LY6H protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 20-140 aa of BC028894 Sequence: SAPAHGLWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP Predict reactive species Full Name: lymphocyte antigen 6 complex, locus H Calculated Molecular Weight: 15 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC028894 Gene Symbol: LY6H Gene ID (NCBI): 4062 RRID: AB_2879366 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O94772 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.